PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008240446.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 459aa    MW: 51068.5 Da    PI: 6.1387
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008240446.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.71.6e-55181481129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdee+++ yL++kv ++++ +  +i e+d++k+ePwdLpkk+k +ekewyfF++rd+ky+tg r+nrat+sgyWkatgkdke++++
  XP_008240446.1  18 LPPGFRFHPTDEEIITSYLTEKVIDSSFVA-IAIGEADLNKCEPWDLPKKAKMGEKEWYFFCQRDRKYPTGMRTNRATESGYWKATGKDKEIFNN 111
                     79*************************988.78***************99999*****************************************8 PP

             NAM  96 kgel...vglkktLvfykgrapkgektdWvmheyrle 129
                     kg++   vg+kktLvfy grapkgekt+Wvmheyrle
  XP_008240446.1 112 KGKAgclVGMKKTLVFYGGRAPKGEKTNWVMHEYRLE 148
                     5555666****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-6214174IPR003441NAC domain
PROSITE profilePS5100559.53118173IPR003441NAC domain
PfamPF023653.4E-2919147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MEQDMVVNRG AEDQLIELPP GFRFHPTDEE IITSYLTEKV IDSSFVAIAI GEADLNKCEP  60
WDLPKKAKMG EKEWYFFCQR DRKYPTGMRT NRATESGYWK ATGKDKEIFN NKGKAGCLVG  120
MKKTLVFYGG RAPKGEKTNW VMHEYRLEGK ISQYTNLSKA AKDEWVVCRV FHKNMGLKKT  180
NNTPTRMNSF GDHDLLDYSS LPPLMDPTSF NNNIMNNNDN KACGYGDQDV KPGTNLASTA  240
PSLSSAKASS SDDHHAINNN NYLSYFSIGR SGGQVQKPNY SFQVQPTNSY YQATSLSNPN  300
MLYPHHHHQF PNPNPNPSSV WFQPNPNNSD YFQQGMIRVT NNITTSDHDE DDQAMLRAIA  360
AANNNSNMNN ETSSSAAAGF GSSGGLERQC KVEQFSSAPQ SMFSLSQDTG ISTDINTTEI  420
SSSLVSSKQE LGSAANNCSS YDQRPSVVPI SDIEGLWDF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-521617915171NO APICAL MERISTEM PROTEIN
1ut4_B2e-521617915171NO APICAL MERISTEM PROTEIN
1ut7_A2e-521617915171NO APICAL MERISTEM PROTEIN
1ut7_B2e-521617915171NO APICAL MERISTEM PROTEIN
3swm_A3e-521617918174NAC domain-containing protein 19
3swm_B3e-521617918174NAC domain-containing protein 19
3swm_C3e-521617918174NAC domain-containing protein 19
3swm_D3e-521617918174NAC domain-containing protein 19
3swp_A3e-521617918174NAC domain-containing protein 19
3swp_B3e-521617918174NAC domain-containing protein 19
3swp_C3e-521617918174NAC domain-containing protein 19
3swp_D3e-521617918174NAC domain-containing protein 19
4dul_A2e-521617915171NAC domain-containing protein 19
4dul_B2e-521617915171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00518DAPTransfer from AT5G18270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981253e-84KF198125.1 Malus hupehensis NAC domain protein (NAC112) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008240446.10.0PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FLR35e-93NAC79_ARATH; NAC domain-containing protein 79
TrEMBLM5VXD40.0M5VXD4_PRUPE; Uncharacterized protein
STRINGPOPTR_0013s05110.11e-138(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.11e-108Arabidopsis NAC domain containing protein 87